GLP-1 (S) (5 mg / 10 mg / 20 mg) ^Sale

Proper Handling

• Reconstitution: GLP-1 is supplied as a lyophilized powder and may be reconstituted with sterile diluent for laboratory use.

• Storage: Store lyophilized vials in a cool, dry environment. Once reconstituted, keep refrigerated (2–8 °C) and use within 30 days.

• Appearance: White to off-white powder prior to reconstitution; clear solution once mixed.

What is GLP-1 (S)?

GLP-1 (S) is a synthetic research peptide belonging to the glucagon-like peptide family. It has been the subject of extensive laboratory investigation for its interaction with GLP-1 receptors and its biochemical properties. The compound’s structure is based on naturally occurring sequences with modifications designed to enhance stability.

Researchers have examined GLP-1 (S) in the context of:

• Receptor binding studies

• Structure–activity relationship analysis

• Investigations into peptide stability and degradation pathways

For Research Use Only. Not for human consumption.

Why Choose Vital Pep Labs GLP-1 (S)?

• ≥ 99% purity (third-party verified)

• Manufactured to cGMP / USP standards

• Certificates of Analysis (COA) available for every batch

• Secure packaging and fast, tracked shipping

  GLP-1 (S) 

Type: Synthetic glucagon-like peptide analog

Molecular Formula: C₁₈₇H₂₉₁N₄₅O₅₉

Molecular Weight: ~4113 g/mol

Amino Acid Sequence (modified):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG — with modifications at position 8 (Aib substitution) and acylation with a C18 fatty diacid chain for enhanced stability.